SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015155 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015155
Domain Number 1 Region: 325-568
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-80
Family Eukaryotic proteases 0.0000343
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000955
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 103-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000105
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 212-257
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 287-326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000851
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000236
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015155   Gene: ENSPPYG00000013553   Transcript: ENSPPYT00000015760
Sequence length 572
Comment pep:known_by_projection chromosome:PPYG2:3:20788388:20821926:-1 gene:ENSPPYG00000013553 transcript:ENSPPYT00000015760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTIYDSLLPIRSSILYRICEPTRTLMSF
VSTNNLMLVTFKSPHIRRLSGIRAYFEVIPEQKCENTVLVKDITGFEGKISSPYYPSYYP
PKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGCEHGWWEINEHMYCGSYMDHQTIFRV
PSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSGLCVPQAQRCDGVNDCFD
ESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDIC
FRKQNAKCDGTVDCPDRSDEEGCTCSRSSSTLHRIIGGTDTLEGGWPWQVSLHFVGSAYC
GASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVSPVRRIVVHEYYNSQTF
DYDIALLQLSIAWPETLKQLIQPICIPPAGQRVRSGEKCWVTGWGRRHEADNKGSLVLQQ
AEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDACKGDSGGPLSCRRKSDGKWILTGIVS
WGHGCGRRNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences H2P9R6
9600.ENSPPYP00000015155 ENSPPYP00000015155 ENSPPYP00000015155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]