SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015229 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015229
Domain Number 1 Region: 98-227
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.04e-26
Family Ricin B-like 0.0026
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.18e-21
Family Crystallins/Ca-binding development proteins 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015229   Gene: ENSPPYG00000013622   Transcript: ENSPPYT00000015836
Sequence length 229
Comment pep:known_by_projection chromosome:PPYG2:3:35281159:35291549:-1 gene:ENSPPYG00000013622 transcript:ENSPPYT00000015836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEKKKVFEEPSISLFALEHCEGRELHLEEAVNSVLNKDLHFYTQSVWVKSGLWIAYEGS
NFLGRQILLRPNEIPNWTAFSRWKTIGSLRPMKQPAVYIRIKNRAQDEYLTVTGNLADTR
ATSVCISPYSGKNTQIWQYCRGLFKSKASDTCLDVIGGRDTPGAKVALWTEHGQFRQKWR
LNKNGTISSYLSDQLVLDVKGGNYCDKTHVIVNQPLEGEETQKWDIEIL
Download sequence
Identical sequences H2P9Y7
ENSPPYP00000015229 9600.ENSPPYP00000015229 ENSPPYP00000015229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]