SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015384 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015384
Domain Number 1 Region: 792-1085
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.23e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000204
Further Details:      
 
Domain Number 2 Region: 59-319
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.15e-79
Family Carbonic anhydrase 0.00000768
Further Details:      
 
Domain Number 3 Region: 1089-1375
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.09e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 343-407
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000054
Family Fibronectin type III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015384   Gene: ENSPPYG00000013752   Transcript: ENSPPYT00000015997
Sequence length 1410
Comment pep:known_by_projection chromosome:PPYG2:3:83760550:84516085:-1 gene:ENSPPYG00000013752 transcript:ENSPPYT00000015997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFVKITSSVLHYVVCFPALTEGYVGALHENRHGSTVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGHHQSPVDILDQYARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEVVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQDLHDRVVSKSAVRDAWNHDMTDFLENPLGTEASKNYMISYSWTKNEDEKE
KTFTKDSDKDLKATISHVSPDSLYLFRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIV
KTGVPTASPASSADMAPISSGSSTWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTL
LAGLGFGGGGISSFPSTVWPTRLPTAASASKQAARPVLATTEALASPGPDGDSSPTKDSE
GTEEGEKDEKSESEDGEREHEEDGEKDSEKKEKSGVTHAAKERNQTEPSPTPSSPNRTAE
GGHQTIPGHEQDHTAVPTDQTGGRRDAGPGPDPDMVTSTQVPPTATEEQYAGSDPKRPEM
PSKKPVSHGDRFSEDSRFITVNPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILL
IAVLVYWRGCNKIKSKGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNES
IPIIPIPDDMEAIPVKQFVKHISELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENK
HKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDF
WRMIWEQNTGIIVMITNLVEKGRRKCDQYWPTENSEEYGNVIVTLKSTKVHACYTVRRFS
VRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPEMGP
VLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDA
LLEAILGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECN
KEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFW
RMIWDHNAQIIVMLPDNQSLAEDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIII
HDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGA
VSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKE
NGNGPMTVDKNGAVLIADESDPAESMESLV
Download sequence
Identical sequences H2PAD6
9600.ENSPPYP00000015384 ENSPPYP00000015384 ENSPPYP00000015384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]