SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015447 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015447
Domain Number 1 Region: 2147-2240
Classification Level Classification E-value
Superfamily C-type lectin-like 4.53e-33
Family Link domain 0.00011
Further Details:      
 
Domain Number 2 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-30
Family FAS1 domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1472-1520,1601-1712
Classification Level Classification E-value
Superfamily FAS1 domain 4.32e-28
Family FAS1 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1714-1867
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-25
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 5 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 6.54e-22
Family FAS1 domain 0.0049
Further Details:      
 
Domain Number 6 Region: 385-498
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-20
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 7 Region: 2238-2401
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-17
Family FAS1 domain 0.0089
Further Details:      
 
Domain Number 8 Region: 1139-1230
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000235
Family FAS1 domain 0.0084
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family Merozoite surface protein 1 (MSP-1) 0.065
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015447
Domain Number - Region: 1370-1496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 901-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000444
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00093
Family Merozoite surface protein 1 (MSP-1) 0.039
Further Details:      
 
Domain Number - Region: 872-910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.069
Further Details:      
 
Domain Number - Region: 829-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family EGF-like domain of nidogen-1 0.072
Further Details:      
 
Domain Number - Region: 1976-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 230-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00712
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 109-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.072
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015447   Gene: ENSPPYG00000013804   Transcript: ENSPPYT00000016060
Sequence length 2509
Comment pep:known_by_projection chromosome:PPYG2:3:93814441:93844595:-1 gene:ENSPPYG00000013804 transcript:ENSPPYT00000016060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRGLLPLCLLAFCLAGFSFVRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWL
RELPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPC
NGHGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGS
CLCFAGYTGPHCDQELPVCQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSP
CSLLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFC
TCRPGLVSINSNASAGCFAFCSPFSCDRSATCQVTADGKTSCVCRESEVGDGRACYGHLL
HEVQKATQTGRVFLHLRVAVAMMDQGCREILTTAGPFTVLVPSVSSFSSRTMNASLAQQL
CRQHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANN
IAANGVFHVVTGLRWQAPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRILTMAN
QVLAVNISEEGRILLGPEGVPLQRVDVMAANGVIHMLDGILLPPTILPILPKHCSEEQHK
IVAGTCVDCQALNTSTCPPNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTIMEQGC
CKGFFGPDCMQCPGGFSKPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQC
QEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGQFCNESMGDCGPTGLAQHCHLHARCVSQ
EGVARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGR
VCVAIDECELDVRGGCHTDALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHG
LATCRAVGGGQRVCTCPPGFGGDGFSCYGDIFRELEANAPFSIFYQWFKSAGITLPADRR
VTALVPSEAAVRQLSPEDRAFWLQPRMLPNLVRAHFLQGALFEEELARLGGQEVATLNPT
TRWEIRNISGRVWVQNASVDVADLLATNGVLHILSQVLLPPRGDVPGGQGLLQQLDLVPA
FSLFRELLQHHRLVPQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSME
TLRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRC
LNSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDC
CPGFFGMLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCT
GVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTC
ACAAGYSGNGIFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINS
CLIHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKST
GDGQRTCTCDTAHTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPH
ADLMSNLSQDELARIRAHRQLVFRYHVVGCQRLRSEDLLEQGYATALSGHPLRFSEREGS
IYLNDFARVVSSDHEAVNGILHFIDRVLLPPEALHWEPDDAPIPRRNVTAAAQGFGYKIF
SGLLKVAGLLPLLREASHRPFTMVWPTDAAFRALPPDRQAWLYHEDHRDKLAAVLRGHMI
RNVEALASDLPNLGPLRTMHGTPISFSCSRMRPGELMVGEDDARIVQRHLPFEGGLAYGI
DQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTSPP
LHSLGLRSVWVHPSLWGRPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSPCS
DRGVCMDGMSGSGQCLCRSGFAGTACELCAPGAFGPHCQACHCTVHGRCDEGLGGSGSCF
CDEGWTGPRCEVQLELQPVCTPPCAPEAVCRAGNSCECGLGYEGDGRVCTVADLCQDGHG
GCSEHANCSQVGTEESEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATSGPYGL
NFSEAEVACEAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSTAHPVVFPAADCGNGRVG
IVSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISMCNGKLLDVLAATANFSTFYGM
LLGYANATQRGLDFLDFLNDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANA
SQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSHIIVWDIMAFNGIIHALASPLLA
PPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARGKPTGFGFSAFQAEDDAED
DFSPWQEGTNPTLVSVPNPVFGSDAFCEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences H2PAJ4
ENSPPYP00000015447 ENSPPYP00000015447 9600.ENSPPYP00000015447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]