SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015516 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015516
Domain Number 1 Region: 455-722
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.08e-58
Family Eukaryotic proteases 0.0000334
Further Details:      
 
Domain Number 2 Region: 380-473
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-34
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 204-286
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 113-202
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-31
Family Kringle modules 0.00023
Further Details:      
 
Domain Number 5 Region: 294-376
Classification Level Classification E-value
Superfamily Kringle-like 1.62e-30
Family Kringle modules 0.00021
Further Details:      
 
Domain Number 6 Region: 34-121
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.9e-17
Family Hairpin loop containing domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015516   Gene: ENSPPYG00000013867   Transcript: ENSPPYT00000016131
Sequence length 724
Comment pep:known_by_projection chromosome:PPYG2:3:96813396:96818964:1 gene:ENSPPYG00000013867 transcript:ENSPPYT00000016131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWWVTVQPPARRMGWLPLLLLLTQCLGVPGQRSALNDFQVLRGTELQHLLHAVVPGPW
QEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDY
IRTCIMNNGAGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGG
PWCYTTDPAVRFQSCGIKSCREAACVWCNGEDYRGAVDRTESGRECQRWDLQHPHQHPFE
PGKFLDQGLDNYCRNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGK
GEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPEKYACKDLRENFCRNPDGSEAPWCFTLR
PGMRVAFCYQIRRCADDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFT
SEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPPSILDPPDQVQFEK
CGKRVDRLDQRRSKLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTARQCFSSC
HMPLTGYEVWLGTLFQNPQHGEPGLQRVPVAKMVCGPSGSQLVLLKLERSVTLNQRVALI
CLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCT
EGLLAPVGACEGDYGGPLACFTHNCWVLEGIIIPNRVCARSRWPAIFTRVSVFVDWIHKV
MRLG
Download sequence
Identical sequences H2PAR3
ENSPPYP00000015516 XP_002813790.1.23681 ENSPPYP00000015516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]