SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015581 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015581
Domain Number 1 Region: 101-364
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-54
Family Eukaryotic proteases 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015581   Gene: ENSPPYG00000013928   Transcript: ENSPPYT00000016201
Sequence length 383
Comment pep:known_by_projection chromosome:PPYG2:3:99875140:99880854:1 gene:ENSPPYG00000013928 transcript:ENSPPYT00000016201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWCQSLARGHRPRTSAPSRAGALLLLLLLLRPAGCWGGGKAPGASCPTADPADRGVQC
VPKDPPVLSSRASPSPGRPRPPHTLLSTTMETQSPVSEGKIDPISLCGFSYEQDPTLQGT
PEGWARRWPWMSACGANDTHICAGTIIASQWVLTVAHCLIRRDVIYSVRVGSPWIDQMTQ
TASDVPVLQVIMHSRYRAQRFWSWVGPRPMSIGLLKLKQELKYSKTCGPICLPGMDYVLK
GTISLCTVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVRIIKSQM
MCAEDTRREQFCYELTGEPLVCSMEGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQQWLW
DCLNGQALALPAPSRTLLLALPL
Download sequence
Identical sequences H2PAX5
ENSPPYP00000015581 9600.ENSPPYP00000015581 ENSPPYP00000015581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]