SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015600 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015600
Domain Number 1 Region: 1-171,206-221
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-50
Family Ribonuclease PH domain 1-like 0.0000000318
Further Details:      
 
Domain Number 2 Region: 307-438
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-32
Family C-type lectin domain 0.000000214
Further Details:      
 
Domain Number 3 Region: 192-274
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.6e-21
Family Ribonuclease PH domain 2-like 0.0000199
Further Details:      
 
Domain Number 4 Region: 286-313
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000785
Family Triple coiled coil domain of C-type lectins 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015600   Gene: ENSPPYG00000013949   Transcript: ENSPPYT00000016221
Sequence length 441
Comment pep:known_by_projection chromosome:PPYG2:3:101562053:101622782:-1 gene:ENSPPYG00000013949 transcript:ENSPPYT00000016221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVALSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILV
GVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
LKTLCISPREHCWILYVDVLLLECGGNLFDAISIAVKAALFNTRIPRVRVLEDEEGSKDI
ELSDDPYDCIRLSVENIPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMR
KVGKGSLDPESIFEMMEVTTEPPTQKPKKIVNAKKDVVNMKMFEELKSRLDTLAQEVALL
KEQQALQTVCVKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYL
RQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAAN
GKWFDKRCRDQLPYICQFGIV
Download sequence
Identical sequences H2PAZ2
ENSPPYP00000015601 ENSPPYP00000015600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]