SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015700 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015700
Domain Number 1 Region: 179-288
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000188
Family Link domain 0.011
Further Details:      
 
Domain Number 2 Region: 278-336
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000032
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015700   Gene: ENSPPYG00000014032   Transcript: ENSPPYT00000016321
Sequence length 768
Comment pep:known_by_projection chromosome:PPYG2:3:113718328:113786208:1 gene:ENSPPYG00000014032 transcript:ENSPPYT00000016321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRVPQTGGGSLGPPRYSPRLPAPSPSAPLCPRSARPGAAPFGTEVSRCPARRRSRVTAAS
SAPQRRPPGVRRPRRSGSASRASSGSPRSSLSARPARSLRFVSQAQSAEPSGARWAVAWA
TPSAARALTRARWPAHSRTMTAEGPSPPARWHRRLPGLWAAALLLLGLPRLSVRADGKLF
VLESQNGSQGLQLEAARLSCKSRGAHLASADELRRVVQDCSFAVCATGWLADGTLGTTVC
SKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPCGDPPSFPNTILQGRTGLEMGD
ELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQACGKDEAEAHIDYEDNFPDDRSVSFR
ELMEDSRTEANEDRGQGDSSEEAPKQDRLVSISVGRENIAWDKAFVPTTGLPGAGSSVPA
DSPGSQLLQKHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYG
NTDGPSGPSVGKNDSKAGDPVVSSSDESWLDGYPVTDGAWRKTEAEEEEDGDRGDGSVGL
DENVLVTPDQPILVEVKKPKSSTLTPSEGMTHSSVLPSQMLDVEALPLRPVNASETEGIG
DGDLTKYQSTLPWRFTTEESPMATLPYELTSSTLEILTATTIKQTPNHIPSMIVATTQPP
VETTVPEIQDSFPYLLSEDFFGQEGPGPGASEELHPTLESCVGDGCPGLSRGPVIATIVT
VLCLLLLLAGVGMVWGYRKCQHKSSVYKLNVGQRQARHYHQQIEMEKV
Download sequence
Identical sequences H2PB84
ENSPPYP00000015700 ENSPPYP00000015700 9600.ENSPPYP00000015700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]