SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015922 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015922
Domain Number 1 Region: 2-34
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000012
Family Homeodomain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015922   Gene: ENSPPYG00000014241   Transcript: ENSPPYT00000016555
Sequence length 151
Comment pep:known_by_projection chromosome:PPYG2:3:161294056:161299797:-1 gene:ENSPPYG00000014241 transcript:ENSPPYT00000016555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGAL
RMPFQQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLATLAADSASAASVV
AAAAAAKTTSKNSSIADLRLKAKKHAAALGL
Download sequence
Identical sequences H2PBU5
ENSPPYP00000015922 ENSPPYP00000015922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]