SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016032 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016032
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-72
Family Kelch motif 0.0000373
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.45e-35
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016032   Gene: ENSPPYG00000014335   Transcript: ENSPPYT00000016675
Sequence length 600
Comment pep:known_by_projection chromosome:PPYG2:3:187482332:187514032:1 gene:ENSPPYG00000014335 transcript:ENSPPYT00000016675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFR
DSRLFTDVIICVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECF
LQYVYTGKVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSL
KTLFTKCKNFALQTFEDVSQHEEFLELDKDELIDYICSDELVIGKEEMVFEAVMRWVYRA
VDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR
LSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPETN
SWLLRAAIPIAKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWMHVQNTFSRQENCGMS
VCNGKIYILGGRRENGEATDTILCYDPATSIITGVAAMPRPVSYHGCVTIHRYNEKCFKL
Download sequence
Identical sequences A0A096MTP2 A0A0D9RLE4 A0A2K5DZS7 A0A2K5J1N1 A0A2K5M8N4 A0A2K5S7Z2 A0A2K6A6W6 A0A2K6LK47 A0A2K6Q6S0 A0A2K6UWV8 F7H164 G1R2C6 G7NZ10 H2PC49 K7DKV0 Q6TFL4
gi|40018614|ref|NP_060114.2| NP_001247513.1.72884 NP_060114.2.87134 NP_060114.2.92137 XP_003256580.1.23891 XP_003256581.1.23891 XP_005247609.1.92137 XP_005247610.1.92137 XP_005247611.1.92137 XP_005247612.1.92137 XP_005247613.1.92137 XP_007970163.1.81039 XP_007970164.1.81039 XP_007970165.1.81039 XP_008572431.1.73410 XP_008572432.1.73410 XP_008955614.1.60992 XP_008955615.1.60992 XP_008955616.1.60992 XP_009237862.1.23681 XP_009237863.1.23681 XP_009237864.1.23681 XP_009445209.2.37143 XP_010335919.1.74449 XP_010335920.1.74449 XP_010364520.1.97406 XP_010364521.1.97406 XP_010364522.1.97406 XP_011511240.1.92137 XP_011801193.1.43180 XP_011801194.1.43180 XP_011841534.1.47321 XP_011841535.1.47321 XP_011889902.1.92194 XP_011889903.1.92194 XP_011889905.1.92194 XP_016797858.1.37143 XP_016797859.1.37143 XP_016797860.1.37143 XP_016797861.1.37143 XP_016797862.1.37143 XP_016862148.1.92137 XP_016862149.1.92137 XP_017393788.1.71028 XP_017393789.1.71028 XP_017393790.1.71028 XP_017716111.1.44346 XP_017716112.1.44346 XP_021530170.1.9421 XP_021530171.1.9421 XP_021530172.1.9421 ENSPPYP00000016032 ENSMMUP00000010571 ENSNLEP00000007348 ENSMMUP00000010571 ENSMMUP00000010572 ENSNLEP00000007348 9544.ENSMMUP00000010571 9600.ENSPPYP00000016032 9606.ENSP00000242810 ENSP00000242810 ENSP00000395012 ENSP00000242810 ENSPPYP00000016032 ENSP00000242810 ENSP00000395012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]