SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016096 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016096
Domain Number 1 Region: 403-695
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.85e-78
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.0000146
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-32
Family Spermadhesin, CUB domain 0.0000266
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000103
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016096   Gene: ENSPPYG00000014391   Transcript: ENSPPYT00000016741
Sequence length 699
Comment pep:known_by_projection chromosome:PPYG2:3:190994055:191073754:-1 gene:ENSPPYG00000014391 transcript:ENSPPYT00000016741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLYHALCFSLSKASAHTVELNDMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRATGNE
CPELQPPVHGKIEPSQAKYSFKDQVLVSCDTGYKVLKDNMEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLVTFSTRNNLTTYKSEIKYSCQEPYYKMLNNITGIYTCSAQGVW
MNKVLGRSLPTCLPVCGLPKFSRKLMARIVIGRPAQKGTTPWIAMLSHLNGQPFCGGSLL
GSSWIVTAAHCLHLSLDPEDPTLHDSDLLSPSDFKIILGKHWRIRSDENEQHLGVKHITL
HPQYDPNTFENDVALVELLESPVLNAYVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPET
LMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQW
YLVGTVSWGEDCGKKDRYGVYSYIHHNKDWIQRVTRVRN
Download sequence
Identical sequences H2PCA7
ENSPPYP00000016096 9600.ENSPPYP00000016096 XP_002814443.2.23681 ENSPPYP00000016096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]