SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016273 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016273
Domain Number 1 Region: 133-341
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.09e-45
Family Prokaryotic proteases 0.00000131
Further Details:      
 
Domain Number 2 Region: 350-445
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-18
Family HtrA-like serine proteases 0.002
Further Details:      
 
Domain Number 3 Region: 26-87
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.0034
Further Details:      
 
Domain Number 4 Region: 73-119
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000099
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016273   Gene: ENSPPYG00000014564   Transcript: ENSPPYT00000016932
Sequence length 448
Comment pep:known_by_projection chromosome:PPYG2:4:4802388:5019297:-1 gene:ENSPPYG00000014564 transcript:ENSPPYT00000016932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQPLPARVTEEPPAAPASLAWSVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLD
SPCGESLECVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACP
LGLHQLSSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLII
TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKPTLCCCVGH
SADLRPGEFWWAIGSPFALQNTVTTGIVSTAQRGGQGAGPPGTPTWDYIHCFLPLQYGNS
GGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQTKDWKKRFIGIRMRTIT
PSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEA
VLTESPLLLEVRRGNDDLLFSIAPEVVM
Download sequence
Identical sequences H2PCS9
9600.ENSPPYP00000016273 ENSPPYP00000016273 ENSPPYP00000016273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]