SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016295 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016295
Domain Number 1 Region: 364-936
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.63e-135
Family alpha-mannosidase, C-terminal domain 0.000064
Further Details:      
 
Domain Number 2 Region: 53-158
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.26e-31
Family alpha-mannosidase 0.00057
Further Details:      
 
Domain Number 3 Region: 226-270
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 0.000000000392
Family alpha-mannosidase, domain 2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016295   Gene: ENSPPYG00000014586   Transcript: ENSPPYT00000016957
Sequence length 938
Comment pep:known_by_projection chromosome:PPYG2:4:6446654:6482083:-1 gene:ENSPPYG00000014586 transcript:ENSPPYT00000016957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVPAPAAAPPLADPEVGLAPSRPAAGMGWLCWLPLLAPLLLLRPPGVQSAGPIRAFVV
PHSHMDVGWVYTVQESMQAYAANVYTSVVEELARGQQRRFIAVEQEFFRLWWDGVASDQQ
KHQVRQLLEGGRLEFVIGGQVMHDEAVTHLDDQILQLTGHPTLHPGSLGTSSGAGTWYQS
PQVLSSVCPSYSPFCKMAGTAPFSTGTWQARMRPAPSPDPVLPPLWGLLQVQHHDAITGT
ESPKVRDMYATHLASGMLGVRKLMASIILDKLQPQAPMAASSGEPGPARRLESLRGSGEG
LNDPSFRLKSWASSSASLGLKPAPSRCLAESGPDSVLPPLWGLLQVQHHDAITGTESPKV
RDMYVMHLASGMLGVRKLMASIILDKLQPQAPMAASSGAGPAGHFASVYNPLAWTVTTIV
TLTVGFPGVHVTDEAGHPVPSQIQNSTETPSVYDLLILTTIPGLSYRHYSIRPTAGAQEG
TQEPAATVATTLQFGRRLRRRTSHVGRHLVPVANDCYTVLLDQDTNLMHSIWERQSNQTV
RVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVEMEIVAGQLVTEIRQYFYRNM
TARNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLELNREAVLRTSTNLNSQQVIYS
DNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRLVLLSERAHGISSQGNGQVEV
MLHRRLWNNFDWDLGYNLTLNDTSIVHPVLWLLLGSWSLTTALRQRSAMALQHRPVVLFG
DLAAQAPHLTGGQTEDKQNIKQLLHLKMSQDSGWRRSLGLHCHLPSVPKGNRGEVQADLH
RVLLRLHHLYEVGEDPVLSQPVTVNLEAVLQALGSVVAVEERSLTGTWDVSMLHRWSWRT
GSGRRRGDTTSPSRPPGGPIITVHPKEIRTFFIHFQQQ
Download sequence
Identical sequences H2PCV0
ENSPPYP00000016295 ENSPPYP00000016296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]