SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016296 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016296
Domain Number 1 Region: 23-440
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.88e-112
Family alpha-mannosidase, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016296   Gene: ENSPPYG00000014586   Transcript: ENSPPYT00000016958
Sequence length 444
Comment pep:known_by_projection chromosome:PPYG2:4:6456724:6474403:-1 gene:ENSPPYG00000014586 transcript:ENSPPYT00000016958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGLLQVQHHDAITGTESPKVRDMYATHLASGMLGVRKLMASIILDKLQPQAPMAASSGAG
PAGHFASVYNPLAWTVTTIVTLTVGFPGVHVTDEAGHPVPSQIQNSTETPSVYDLLILTT
IPGLSYRHYSIRPTAGAQEGTQEPAATVATTLQFGRRLRRRTSHVGRHLVPVANDCYTVL
LDQDTNLMHSIWERQSNQTVRVTQEFLEYHVNGDVKQGPISDNYLFTPGKAAVPAWEAVE
MEIVAGQLVTEIRQYFYRNMTARNYTYAIRSRLTHVPQGHDGELLCHRIEQEYQAGPLEL
NREAVLRTSTNLNSQQVIYSDNNGYQMQRRPYVSYVNNSIARNYYPMVQSAFMEDGKSRL
VLLSERAHGISSQGNGQVEVMLHRRLWNNFDWDLGYNLTLNDTSIVHPVLWLLLGSWSLT
TALRQRSAMALQHRPVVLFGDLAG
Download sequence
Identical sequences H2PCV1
ENSPPYP00000016296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]