SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016449 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016449
Domain Number 1 Region: 175-421
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.95e-81
Family Eukaryotic proteases 0.0000597
Further Details:      
 
Domain Number 2 Region: 42-165
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000392
Family SEA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016449   Gene: ENSPPYG00000014725   Transcript: ENSPPYT00000017118
Sequence length 422
Comment pep:known_by_projection chromosome:PPYG2:4:50999792:51050220:-1 gene:ENSPPYG00000014725 transcript:ENSPPYT00000017118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYRPDVVRARKRVCWEPWVIGLVIFISLIVLAVCIGLTVHYVRYNQKKTYNYYSTLSFT
TDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFRQTKHGVLEQML
ICRFHATEDPETVNKIVQLVLHEKLQDAVGPPKVDPQSVKIKKINKTETDSYLNHCCGTR
RSKTLGQSLRIVGGTEVEEGEWPWQASLQLDGSHRCGATLINATWLVSAAHCFTTYKNPA
RWTASFGVTIKPSKMKRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDA
SYEFQPSDVMFVTGFGALKNDGYSQNHLRQAQVTLIDTTTCNEPQAYNDAITPRMLCAGS
LKGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWITSKT
GI
Download sequence
Identical sequences H2PDA0
9600.ENSPPYP00000016449 ENSPPYP00000016449 ENSPPYP00000016449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]