SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016452 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016452
Domain Number 1 Region: 165-415
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.77e-84
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 36-159
Classification Level Classification E-value
Superfamily SEA domain 1.26e-22
Family SEA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016452   Gene: ENSPPYG00000014727   Transcript: ENSPPYT00000017121
Sequence length 416
Comment pep:known_by_projection chromosome:PPYG2:4:51290266:51310597:1 gene:ENSPPYG00000014727 transcript:ENSPPYT00000017121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRHGISSQRSWPLWTTIFIFLGVAAILGVTIGLLVHFLAVEKTYYYQGDFHISGVTYND
NCENAASQASTNLSKDTETKMLNAFQNSSIYKEYVKSEVIKLLPNANGSNVQLQLQFKFP
PAEKVSMRTKIKAILHQMLKNNMASWNAVPASIKLMEISKAASEMLTNNCCGRQVANSII
NGNKIVNGKSSLMGAWPWQASMQWKGRHYCGASLISSRWLLSAAHCFAKKNNSKDWTVNF
GIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTKYIRRICLPEAKMKLSE
NDNVVVTGWGTLYMNGSFPVILQEAFLKIIDNKICNASYAYSGFVTDTMLCAGFMSGEAD
ACQNDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKTGL
Download sequence
Identical sequences H2PDA3
ENSPPYP00000016452 XP_002814783.1.23681 XP_009238233.1.23681 9600.ENSPPYP00000016452 ENSPPYP00000016452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]