SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016453 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016453
Domain Number 1 Region: 196-437
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.09e-83
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 49-174
Classification Level Classification E-value
Superfamily SEA domain 1.18e-27
Family SEA domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016453   Gene: ENSPPYG00000014728   Transcript: ENSPPYT00000017122
Sequence length 438
Comment pep:known_by_projection chromosome:PPYG2:4:51402799:51485585:1 gene:ENSPPYG00000014728 transcript:ENSPPYT00000017122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYSPVEFSEAEFSRVEYQRKQQFWDSVRLALFTLAIVAIMGIAIGIVTHFVVEDDKSFY
YLASFKVTNIKYKENYGIRSSREFIERSHQIERMMSRIFRHSSVDGRFIKSHVIKLSPDE
QGVDILIVLIFRYPSTDSAEQIKKKIEKALYQSLKTKQLSLTINKPSFRLTPIDSKKMRN
LLNSRCGIRMTSSNMPLPASSSTERIVQGRETAMQGEWPWQASLQLIGSGHQCGASLISN
TWLLTAAHCFWKNKDPTQWIATFGATITPPTMKRNVRKIILHENYHRETNENDIALVQLS
ARVEFSNIVQRVCLPDSSIKLPPKTSVFVTGFGSIVDDGPVQNTLRQARVETISTDVCNR
KDVYDGLITPGMLCAGFMEGKIDACKGDSGGPLVYDNHDIWYIVGIVSWGQSCALPKKPG
VYTRVTKYRDWIASKTGM
Download sequence
Identical sequences H2PDA4
ENSPPYP00000016453 ENSPPYP00000016453 9600.ENSPPYP00000016453 XP_002814784.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]