SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016454 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016454
Domain Number 1 Region: 163-369
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.33e-57
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 38-163
Classification Level Classification E-value
Superfamily SEA domain 4.71e-23
Family SEA domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016454   Gene: ENSPPYG00000014730   Transcript: ENSPPYT00000017124
Sequence length 390
Comment pep:known_by_projection chromosome:PPYG2:4:51578141:51634540:1 gene:ENSPPYG00000014730 transcript:ENSPPYT00000017124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYRTVGFGTQSRNLKPWMIAVLIVFFLTVVAVTIGLLVHFLVFDQKMEYYHGSFKILDP
QINNNFGQSNTYRLKDLRETTENLVDEIFIDSAWKKNYIKNRVVRLTPEEDGVKVDVIMV
FQFPSTEQRAVREKKIQSILNQKIRNLRALPINASSVQVNAMSSSTGELTVQASCGKRVV
PLNVNRIASGVIAPKAAWPWQASLQYDNIHQCGATLISNTWLVTAAHCFQKYKNPHQWTV
SLGTKINPPLMKRNVRRFIIHEKYRSAAREYDIAVVQVSSRVTFSDDIRRICLPEASASF
QPNLTVYITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGI
YDACRGDWGTFSHKGSERYLVSHWNCELGR
Download sequence
Identical sequences H2PDA5
ENSPPYP00000016454 ENSPPYP00000016454 9600.ENSPPYP00000016454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]