SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016724 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016724
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.84e-108
Family Inorganic pyrophosphatase 0.0000000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016724   Gene: ENSPPYG00000014975   Transcript: ENSPPYT00000017403
Sequence length 334
Comment pep:known_by_projection chromosome:PPYG2:4:110034764:110146983:-1 gene:ENSPPYG00000014975 transcript:ENSPPYT00000017403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQY
VKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSC
GEVIHVKILGILALIDEGETDWKLIAINVNDPEASKFHDIDDVKKFKPGYLEATLNWFRL
YKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPF
RCTQEEARSLVELVSYSPNKESNEEEQVWHFLGK
Download sequence
Identical sequences H2PE15
XP_002815072.1.23681 ENSPPYP00000016724 9600.ENSPPYP00000016724 ENSPPYP00000016724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]