SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016746 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016746
Domain Number 1 Region: 297-549
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-67
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 85-193
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0078
Further Details:      
 
Domain Number 3 Region: 233-270
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 198-231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016746   Gene: ENSPPYG00000014995   Transcript: ENSPPYT00000017426
Sequence length 558
Comment pep:known chromosome:PPYG2:4:114416123:114477981:-1 gene:ENSPPYG00000014995 transcript:ENSPPYT00000017426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVCSFEIFFQRLKIKFQKNTWGGKEFSAETKTPNTSNMKLLHVFLLFLCFHLSFCKFPTY
CQQKSLECLRPGTKFLNNGTCTAKGKFSVSLKHGNTDSEGIVEVKLVDQDKTMFICKSSW
SMREANVACLDLGFQQGADTQRRFKLSNLSINSTECLHVHCRGLETSLAECTFTKRRTMG
YQDLADVVCYTQKADSPTNDFFQCVNGKYISQMKACDGINDCGDQSDELCCKACQGKSFH
CKSGVCIPSQYRCNGEVDCITGEDEVGCEGFASVAQEETEILTADMDAERRRIKSLLPKL
SCGVKNRRHIRRKRIVGGKRAQLGDLPWQVGIKDASGITCGGIYIGGCWILTAAHCLRAS
KTHHYQIWTTVVDWIHPDRKRIVIEYVDRIIFHENYNAGTYQNDIALMEMKKDGNKKDCE
LPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNEKVFSLQWGEVKLISNCSKFYGSRFYE
KEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYTKVANY
FDWISYHVGRPFISQYNV
Download sequence
Identical sequences H2PE37
ENSPPYP00000016746 9600.ENSPPYP00000016746 ENSPPYP00000016746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]