SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016844 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016844
Domain Number 1 Region: 52-255,340-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-60
Family Calnexin/calreticulin 0.0000000691
Further Details:      
 
Domain Number 2 Region: 231-333
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.32e-22
Family P-domain of calnexin/calreticulin 0.0000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016844   Gene: ENSPPYG00000015078   Transcript: ENSPPYT00000017525
Sequence length 542
Comment pep:known_by_projection chromosome:PPYG2:4:145822249:145855266:-1 gene:ENSPPYG00000015078 transcript:ENSPPYT00000017525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQAFWLCLGLLFISINAEFMDDDVEMEDFEENSEEIDVNEGELPSEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIELKNQVPGDGLVKSRAKHHAISA
VLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDK
CGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLDESEPAQIEDSNV
VKPAGWLDDEPKFIPDPNAEKPDDWNEDMDGEWEAPQILNPACRIGCGEWKPPMIDNPKY
KGVWRPPLVDNPNYQGIWSPRKIPNPDYFVDDHPFLLTSFSALGLELWSMTSDIYFDNFI
ICSEKEVADHWAADGWRWKIMIANANEPGVLKQLMAAAEGHPWLWLIYLVTAGVPIAFIT
SFCWPRKVKKKYKDTECKKTDICIPQTKGVLEQEGKEEKAALEKPIDLEEEKKQNDGEML
EKEEESEPEEKSEEEIEIIEGQEERNKSNKSGSEDEMKEADVSTGSGDGPIKSVRKRRVR
KD
Download sequence
Identical sequences H2PEC9
9600.ENSPPYP00000016844 ENSPPYP00000016844 ENSPPYP00000016844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]