SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016897 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016897
Domain Number 1 Region: 8-276
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.63e-84
Family Eukaryotic proteases 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016897   Gene: ENSPPYG00000015119   Transcript: ENSPPYT00000017578
Sequence length 337
Comment pep:known_by_projection chromosome:PPYG2:4:156991788:157006926:1 gene:ENSPPYG00000015119 transcript:ENSPPYT00000017578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAGCAFTLLLLLGSCSRSFPKKKELQSVCGRPVYSSRVVGGQDAAAGRWPWQVSLHFD
HNFICGGSLVSERWILTAAHCIQPTWSTFSYTVWLGSIKVGDSRKSVKYYVSKIVIHPKY
QDTTADVALLKLSSQVTFTSAILPICLPNVTKQLAIPAFCWVTGWGKVKERDYHSTLQEA
EVPIIDRQACEHLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGV
WIQIGVVSWGLECGKSLPGVYTNVIYYQKWINATISRANNLDFSDFLFPIVLLSLALLRP
SCAFGPNIIHRVGTVAEAVACIQGWEENAWRFSPRGR
Download sequence
Identical sequences H2PEI1
ENSPPYP00000016897 ENSPPYP00000016897 9600.ENSPPYP00000016897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]