SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016984 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016984
Domain Number 1 Region: 120-374
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.13e-53
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000275
Further Details:      
 
Domain Number 2 Region: 380-512
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.03e-29
Family Ricin B-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016984   Gene: ENSPPYG00000015201   Transcript: ENSPPYT00000017671
Sequence length 527
Comment pep:known_by_projection chromosome:PPYG2:4:178702693:180042044:1 gene:ENSPPYG00000015201 transcript:ENSPPYT00000017671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKQKRFLQMTLLFTVALIFLPNIGLWSLYKDKHLVKSAEPGEQQTFPLGLGDGQFYSW
TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSNNIALER
SLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDD
FSEREHLKNKLEEYMARFSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVN
WLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQR
ADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPC
SRVGHIYRKYVPYKVPSGTSLARIRNVAANLCVDSKHGATGTELRLDICVKDGSERTWSH
EQLFTFGWREDIRPGEPLHTRKYCFDAISHNSPVTLYDCHGLKGNQLWGYRKDRTLFHPV
SNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLETFNHHASS
Download sequence
Identical sequences H2PER7
ENSPPYP00000016984 9600.ENSPPYP00000016984 ENSPPYP00000016984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]