SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016986 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016986
Domain Number 1 Region: 186-520
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.24e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 525-654
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.16e-31
Family Ricin B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016986   Gene: ENSPPYG00000015203   Transcript: ENSPPYT00000017673
Sequence length 657
Comment pep:known chromosome:PPYG2:4:180173773:180323160:1 gene:ENSPPYG00000015203 transcript:ENSPPYT00000017673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKIGFILRSLLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLA
PGEDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTF
TYRDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVAS
DMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLA
EIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYL
DAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIPQGGGDEDGYARGAWDWSM
LWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEIS
YKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDYF
YASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPPKNVDWGEIRGF
ETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYDQCLTKGADGSKVMITHC
NLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSSKTTQKWEMNNIHSV
Download sequence
Identical sequences A0A2J8R9E9 Q5RFJ6
9600.ENSPPYP00000016986 NP_001124628.1.23681 ENSPPYP00000016986 ENSPPYP00000016986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]