SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017045 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017045
Domain Number 1 Region: 219-634
Classification Level Classification E-value
Superfamily Cytochrome P450 1.7e-115
Family Cytochrome P450 0.0000102
Further Details:      
 
Domain Number 2 Region: 998-1242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-91
Family Eukaryotic proteases 0.000000696
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017045
Domain Number - Region: 740-767
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00108
Family Pan module (APPLE domain) 0.055
Further Details:      
 
Domain Number - Region: 915-957
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0145
Family Pan module (APPLE domain) 0.023
Further Details:      
 
Domain Number - Region: 654-677
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0147
Family Pan module (APPLE domain) 0.062
Further Details:      
 
Domain Number - Region: 835-859
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0981
Family Pan module (APPLE domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017045   Gene: ENSPPYG00000015256   Transcript: ENSPPYT00000017737
Sequence length 1254
Comment pep:known chromosome:PPYG2:4:194467196:194532748:1 gene:ENSPPYG00000015256 transcript:ENSPPYT00000017737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPFPFRAGCPPAESRRSERPRRTRRPAPPGALGCRGDRSDAPDPPSRGGRKCRRPPPG
PASGPPVQSLRPGARKPFSGLSLSAGAWRPRCCVGGAGRRNSPVAPSLAAAQAGNVVPET
GRPGSGERARSARGSGRCAAGTASHHAPAGRTCPEWTSRPPARAMAGLWLGLVWQKLLLW
GAASAVSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKRDGREFFQQ
IIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLL
TSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHVNQEAFNCFFYITLCA
LDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFQRIKMPWLWLDLWYLMFKEGWEHKK
SLKILHTFTNNVIAERANEMNADEDCRGVGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSH
EDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVLGKSDRPATVEDLK
KLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNP
EEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGCLTQLYENTFFRGGDVASMYTPNAQYC
QMMCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAISGHSLKQCGHQ
ISACHRDIYKGIDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHNAEYRNNCL
LKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVC
RTICTYHPNCLFFTFYTNAWKIESQRRNLNVCLLKTSESGTPSSSAPQENTISGYSLLTC
KRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEK
CKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDSSVCTTKTSARIVGGTNSSWGEWPW
QVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLLDVWRIYSGILNLSDITKETPFS
QIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPAKGDTNAIYTNCWVTGWGF
SKEKGEIQNILQKVNIPLVTNEECQKRYEDYKITQRMVCAGYKEGGKDACKGDSGGPLVC
KHNGMWRLVGITSWGEGCARREQPGVYTRVAEYVDWILEKTQSSDGKAWMQSPA
Download sequence
Identical sequences H2PEX4
ENSPPYP00000017045 ENSPPYP00000017045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]