SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017048 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017048
Domain Number 1 Region: 381-623
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-89
Family Eukaryotic proteases 0.00000000601
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000017048
Domain Number - Region: 130-154
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000549
Family Pan module (APPLE domain) 0.014
Further Details:      
 
Domain Number - Region: 298-335
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00432
Family Pan module (APPLE domain) 0.029
Further Details:      
 
Domain Number - Region: 221-244
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0131
Family Pan module (APPLE domain) 0.075
Further Details:      
 
Domain Number - Region: 30-63
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0188
Family Pan module (APPLE domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017048   Gene: ENSPPYG00000015257   Transcript: ENSPPYT00000017740
Sequence length 625
Comment pep:known_by_projection chromosome:PPYG2:4:194540777:194562760:1 gene:ENSPPYG00000015257 transcript:ENSPPYT00000017740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLYQMVHFILFTSVSGECVTQLFKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFT
FTAESPSEDPTQWFTCVLKDSVTETLPRVNRTAAISGYSLKQCSHQISACNKDTYVDLDM
KGINYNSSVAKSAQECQERCTDDVHCHFFTYATGQFPSLEHRNICLLKHTQTGTPTRIMK
LDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCRRICTHHPGCLFFT
FFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTD
FLGEELDIVAVKGHEACQKLCTNTVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKIL
HGRGGISGYTLRLCKMDNGCTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYD
IALLKLETTVNYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLV
TNEECQKRYRGHKITHRMICAGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCA
QRERPGVYTNVVEYVDWILEKTQAV
Download sequence
Identical sequences H2PEX7
ENSPPYP00000017048 ENSPPYP00000017048 9600.ENSPPYP00000017048 XP_002815399.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]