SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017116 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017116
Domain Number 1 Region: 66-102
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000497
Family Ribosomal protein L36 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017116   Gene: ENSPPYG00000015322   Transcript: ENSPPYT00000017811
Sequence length 103
Comment pep:known_by_projection chromosome:PPYG2:5:1807052:1807363:-1 gene:ENSPPYG00000015322 transcript:ENSPPYT00000017811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLFIRKMVNPLLYLSRHTVKPRALSTFLFGSLRGAAPVAVEPGTEVRSLLSPGLLPHL
LPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQREM
Download sequence
Identical sequences H2PF45
ENSPPYP00000017116 XP_002815442.1.23681 XP_009238836.1.23681 XP_009238837.1.23681 XP_009238838.1.23681 ENSPPYP00000017116 9600.ENSPPYP00000017116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]