SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017280 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017280
Domain Number 1 Region: 27-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.2e-72
Family Eukaryotic proteases 0.0000000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017280   Gene: ENSPPYG00000015464   Transcript: ENSPPYT00000017983
Sequence length 264
Comment pep:known_by_projection chromosome:PPYG2:5:56282528:56292307:1 gene:ENSPPYG00000015464 transcript:ENSPPYT00000017983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFCSFSLFFLIVGAYMTPVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQ
WVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLAIKKFIPFSRVTSDPQSNDIMLV
KLQTAAKLNKHVKLLHIRSKTSLRSGTKCEVTGWGATNPDLLRLSDTLREVTVTVLSRKL
CNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVAKKP
GIYTLLTKKYQTWIKSNLVPPHTN
Download sequence
Identical sequences H2PFJ9
ENSPPYP00000017280 XP_002815603.1.23681 ENSPPYP00000017280 9600.ENSPPYP00000017280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]