SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017455 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017455
Domain Number 1 Region: 3134-3292
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 143-259
Classification Level Classification E-value
Superfamily C-type lectin-like 5.65e-41
Family Link domain 0.002
Further Details:      
 
Domain Number 3 Region: 252-353
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 4 Region: 28-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000357
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 3293-3351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000125
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 3090-3130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000286
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017455   Gene: ENSPPYG00000015613   Transcript: ENSPPYT00000018162
Sequence length 3395
Comment pep:known_by_projection chromosome:PPYG2:5:83695837:83804174:1 gene:ENSPPYG00000015613 transcript:ENSPPYT00000018162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFINIKSILWMCSTLIVTLALHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIEDTQDTVSLAVDGVVFHYRAATSRYTLNFEAAQKACLDIGAVIA
TPEQLFAAYEDGFEQCDAGWLSDQTVRYPIRAPRVGCYGDKMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTVPNKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFDNQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTSVIPLVDELPVIPTEFPPVGNIVNFEQKATVQPQAVTDSLA
TKLPTPTGSTKKPWDMDDYSPSASGPLGKLDISEIKEEVLQSTTGVSHYATDSWDGVVED
TQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFAVTETPFVTARMTLESKTEKKMVSTVS
ELITTGHHGFTLGEEDDEDRTLTVGSDESTLIFDQVPEVITVSKTSEDTIHTQLEDLESV
SASTTVSPLIMPDNNGSSMDDWEERQTSSRITEEFLGKYLSTTPFLSQHHTEIELFPYSG
DKILVEGISTVIYPSLQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEEV
FSGVKLSTSPSEPIHVTESSVEMTKSFDFPTLITKLSAEPTEVRDKEEDFTATPGTTKYD
ENITTVLLAHGTLSVEAATVSKWSWDEDNTTSKPLESTEPSASSKLPPALLTTVGMNGKD
KEIPSFTEDGVDEFTLIPDSTQKQLEEVTDEDIAAHGKFTIRFQPTTSIGIAEKSTLRDS
TTEEKVPPITSTEGQVYATMEGSALDEVEDVDLSKPVSTVPQFAHTSEVEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDILVIDQTRLEATISPET
MRTTKITEGTTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGNGSAYTVSEDEL
LTGSERVPVLETTPVGKIDHSVSYPPGAVTEHKVKIDEVVTLTPHIGPKVSLSPGPEQKY
ETEGSSTTGFTSSLSPFSTHVTQLMEETTTEKTSLEDIDLGSGLFEKPKATELIEFSTIK
VTVPSDITTAFSSVDRLHTTSAFKPSSAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPSATQPTRPPTVEDKEAFGPQALSTPQPPARTKFHP
DINVYIIEVRENKTGRMSDLSVIGHPIDSESKEDEPCSEETDPVHDLMAEILPEFPDIIE
IDLYHSEENEEEEEECANATDVTTTPSVQYINGKHLVTTVPKDPEAAEARRGQFESVAPS
QNFSDSSESDTHPFVTAKIELSTAVQPNESTETTESLEITWKPETYPETSEHFSGGEPDV
FPTVPFHEEFESGTAKKGAESVTERDTEVGHQAHDHTEPVTLFPEESSGEIAIDQESQKI
AFARATEVTFGEEVEKSTSVTYTPTIVPSSASAYVSEEETVTLIGNPWPDDLLSTKESWV
EATPRQVVELSGSSSIPITEGSGEAEADEDTMFTMVTDLSQRNTTDTLITLDTSRIITES
FFEVPATTIYSVSEQPSAKVVPTKFVSKTDTSEWISSTSVEEKKRKEEEGTTGTASTVEV
YSPTQRSDQLILPSELESPNVATSSDSGTRKSFMSLTTPTQSEREMTDSTPVFTETNTLE
NLGAQTTEHSSIHQPGVQEGLSTLPRSPASVFMEQGSGEAAADPETTTVSSFSLNLEYEI
QAKKEAAGTSSPHVETTFSTEPTGLVLSTVMDREVAENISQTSREIVISERLGEPNYGAE
IRGFSTGFPLEEDFSGDFREYSTVSHPIAKEEMVMMEGSGDAAFRDTQTLPSTVPTSVHI
SHISDSEGPSSTMVSTSAFPWEEFTSSAEGSGEQLVTVSSSVVPVLPSAVGKFSGTASSI
IDEGLGEVGTVNEIDRRSTILPTAEVEGTKAPVEKEEVKVHGTISTNFPQTMEPAKLWSR
QEVNPVRQEIESETTSEEQIQEEKSFESPQNSPATEQTIFDSQTFTETELKTTDYSILTT
KKTYSDDKEMKEEDTSLVNMSTPDPDANGLESYTTLPEATEKSHFFLATALVTESIPAEH
VVTDSPIKKEESTKHFPKGMRPTIQESDTELLFSGLGSGEEVLPTLPTESVNFTEVEQIN
NTLYPHTSQVESTSSDKTEDSNRMENVAKEVGPLVSQTDIFEGSGSVTSTTLIEILSDTG
VEGPTVAPLPFSTDIGHLQNQTLRWAEEIQTSRPQTITEQDSNKNSSTAEINETTTSSTD
FLARAYGFEMAKEFVTSAPKPSDLYYEPSGEGSGEVDIVDSFHTSATTQATRQESSTTFF
SDGSLEKHPEVPSAKAVTADGFPTVSVMLPLHSEQNKISPGPTSTLSNTVSYERSTDGSF
QDRFREFEDSTLKPNRKKPTENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDI
DHTKPVYEDILGMQTDIDPEVPSEPHDSNDESKDDSTQVQETYEAAVNLSLTEETFEGSG
DVLASYTQATHDESMTYEDRSQLGHMGFNFTTGIPAPSTETELDILLPTATSLPIPHKSA
TVIAEIEGIKAEAKALDDMFESSTLSDGQAIADQSEIIPTLGQFERTQEYEDKKHAGPSF
QPEFSSGAEEALVDHTPYLSIATTHLMDQSLTEVPNVMEGSNPPYYTDTTLAVSAFAKLP
SQTPSSPLTLYSGSEASGHTEIPQPSALPGIDVSSSVMSPQDSFKEIHVNIEATFKPSSE
EYLHVTKPPSLSPDTKLEPSEDDGKPESLEETEASPTELIAVEGTEILQDFQNKTDGQVS
GEAIKMFSTIKTPEAGTVITTADEIKLEGATQWPHSTSASATYGVEAGVVPWLSPQTSER
PTLSSSPEINPETQAALIRGQDSTTAGSEQQVAARILDSNNQATVTPVEFNTEVATPPFS
LLETSNETDFLIGINEESVEGTAIYLPGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSG
DQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCY
KYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTD
GSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPV
VENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRT
YSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
Download sequence
Identical sequences H2PG14
XP_002815763.1.23681 ENSPPYP00000017455 ENSPPYP00000017455 9600.ENSPPYP00000017455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]