SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017456 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017456
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-39
Family Link domain 0.009
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 8.44e-24
Family Link domain 0.0024
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017456   Gene: ENSPPYG00000015614   Transcript: ENSPPYT00000018163
Sequence length 354
Comment pep:known_by_projection chromosome:PPYG2:5:83869907:83907869:-1 gene:ENSPPYG00000015614 transcript:ENSPPYT00000018163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDN
DASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAAIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLSDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences H2PG15
9600.ENSPPYP00000017456 ENSPPYP00000017456 XP_002815765.1.23681 XP_009239144.1.23681 ENSPPYP00000017456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]