SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017470 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000017470
Domain Number - Region: 69-99
Classification Level Classification E-value
Superfamily LysM domain 0.000109
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017470   Gene: ENSPPYG00000015625   Transcript: ENSPPYT00000018177
Sequence length 306
Comment pep:known_by_projection chromosome:PPYG2:5:91059255:91074296:-1 gene:ENSPPYG00000015625 transcript:ENSPPYT00000018177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGVQSSGQVHAFGNCSDNDILEEDAEVYELRSRGKEKVRRSTSRDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSVKIPVKKFSSLTET
LCPPKGRQTSRHSSVQYSSEQQEILPANDSLAYSDSAGSFLKEVDRDIEQIVKCTDNKRE
NLNEVVSALTAQQIRFEPDNKNTQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSKITPPSQQREMENGIVPTKGIHFSQQDDHKLYSQDSQSP
ATQQET
Download sequence
Identical sequences H2PG28
ENSPPYP00000017470 9600.ENSPPYP00000017470 XP_002815775.2.23681 ENSPPYP00000017470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]