SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017598 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017598
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 6.54e-31
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017598   Gene: ENSPPYG00000015737   Transcript: ENSPPYT00000018308
Sequence length 445
Comment pep:known_by_projection chromosome:PPYG2:5:128887305:128917549:1 gene:ENSPPYG00000015737 transcript:ENSPPYT00000018308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQ
PPLPPVRPSAPLPFVPPPAVPSVPQLVTSMPPPVSPSTAATFGNPPVSHFPPSTSAPNTL
LPAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSL
AQGTGTTSAITFPEEQEDPRINRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHL
ETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAARAIAGMYKQRLPPRTV
Download sequence
Identical sequences H2PGF1
XP_009239278.1.23681 XP_009239279.1.23681 ENSPPYP00000017598 ENSPPYP00000017598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]