SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017603 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017603
Domain Number 1 Region: 217-401
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.44e-50
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017603   Gene: ENSPPYG00000015742   Transcript: ENSPPYT00000018313
Sequence length 408
Comment pep:known_by_projection chromosome:PPYG2:5:130477759:130496783:1 gene:ENSPPYG00000015742 transcript:ENSPPYT00000018313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSTGSQNRCRRGASWKLRERSRLGKLEGADPAGERRRSLAHARTSAPPPTLPPRPALRG
GEESARAAVFRTRPFASASWRAGWLRREAGPRRPAGCASAASELADARGNMAAAEPAVLA
LPNSGAGGAGAPSGTVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGDQIDMHRKFVV
QLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDMQERFRPAI
KYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLP
EVEVALAEIPGVRSVVLFGVETHVCIQQTALELVGRGVEVHIVADATSSRSMMDRMFALE
RLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences H2PGF6
ENSPPYP00000017603 ENSPPYP00000017603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]