SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017874 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017874
Domain Number 1 Region: 72-388
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.78e-55
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000623
Further Details:      
 
Domain Number 2 Region: 395-492
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.37e-21
Family Ricin B-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017874   Gene: ENSPPYG00000015973   Transcript: ENSPPYT00000018590
Sequence length 494
Comment pep:known_by_projection chromosome:PPYG2:5:156432037:156573472:1 gene:ENSPPYG00000015973 transcript:ENSPPYT00000018590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHSRQKKTFILGDGQKLKDWHDKEAIWRDAQRIGNGEQGRPYPMTDAERVDQAYRENGF
NIYVSDKISLNRSLPDIRHPNCSKRYLETLPNTSIIIFHNEGWSSLRTVHSVLNRSPPEL
AEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLD
SHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRI
PIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCG
GRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSA
GDVAVQKKLRTSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHG
ALGSPLRLEGCIRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYD
CHSMKGNQLWKYRK
Download sequence
Identical sequences H2PH55
9600.ENSPPYP00000017874 ENSPPYP00000017874 ENSPPYP00000017874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]