SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017963 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017963
Domain Number 1 Region: 5-288
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.14e-97
Family Inorganic pyrophosphatase 0.000000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017963   Gene: ENSPPYG00000016051   Transcript: ENSPPYT00000018682
Sequence length 292
Comment pep:known_by_projection chromosome:PPYG2:5:175633186:175634064:1 gene:ENSPPYG00000016051 transcript:ENSPPYT00000018682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFGTKEHAAPFSLEYRVFLKNEKGQYISPLNIFHDIPIYADKDVFHMVVEVPRWSNAK
MEIATKDPLNPIKQDVKKRKLRYVANLFLYKGYIWNYGAIPQTWEDPGHNDKHTGCCDYN
DPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKR
LKPGYLEAAVDWFRRNKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALGTKKTNR
KGISCMNTIVSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences H2PHE0
9600.ENSPPYP00000017963 ENSPPYP00000017963 ENSPPYP00000017963 XP_009239565.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]