SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018041 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018041
Domain Number 1 Region: 60-268,355-392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-83
Family Calnexin/calreticulin 0.00000000189
Further Details:      
 
Domain Number 2 Region: 236-345
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.36e-44
Family P-domain of calnexin/calreticulin 0.000000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018041   Gene: ENSPPYG00000016126   Transcript: ENSPPYT00000018762
Sequence length 527
Comment pep:known_by_projection chromosome:PPYG2:5:182311338:182343414:1 gene:ENSPPYG00000016126 transcript:ENSPPYT00000018762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
DEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAP
GCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGL
ELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLW
VVYILTVALPVFLVILFCCSGKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGE
EKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences H2PHL6
ENSPPYP00000018041 ENSPPYP00000018041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]