SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018079 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018079
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily E set domains 3.22e-17
Family Other IPT/TIG domains 0.00000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018079   Gene: ENSPPYG00000016162   Transcript: ENSPPYT00000018800
Sequence length 924
Comment pep:known chromosome:PPYG2:6:377754:529868:-1 gene:ENSPPYG00000016162 transcript:ENSPPYT00000018800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLRPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSF
EQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHKWILQLMHSCKEGYVKELKGNPGLHSPMLDLDNDTRPSVLGH
LSQTASLRGAAAFICRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFSE
TAEKSGQIERSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLSIRDGEAKQYGGWELKC
ELSGQWLAHAIQTVRLTHESLTALEIPNDLLQTIQDLILDLRVRCIMVTLQHTAEEIKRL
AEKEDWVVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSIN
IMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYL
ERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYA
GYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQ
CVSSFSKNGALQVTKSFNLILNLLQLQCGCVCSRSSFKQALEALPQLSSGADKKLLEELL
NKFKSSMHLQLTCFQAASSTMMKT
Download sequence
Identical sequences H2PHQ4
ENSPPYP00000018079 ENSPPYP00000018079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]