SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018204 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018204
Domain Number 1 Region: 58-533
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-164
Family ALDH-like 0.0000000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018204   Gene: ENSPPYG00000016280   Transcript: ENSPPYT00000018929
Sequence length 535
Comment pep:known_by_projection chromosome:PPYG2:6:25565730:25610221:1 gene:ENSPPYG00000016280 transcript:ENSPPYT00000018929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWLRSCGAQRLGSTFPGCRLRPRAGGLVPASRPAPCPAQLRGYAGGLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCSWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY
TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF
AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATIVTGGKRHQLGKNFF
EPTLLCNVTQDMLCTHEETFGPLAPVIKFNTEEEAIAIANAADVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences H2PI26
ENSPPYP00000018204 ENSPPYP00000018204 9600.ENSPPYP00000018204 XP_002816528.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]