SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018207 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018207
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.02e-34
Family PaaI/YdiI-like 0.000000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018207   Gene: ENSPPYG00000016283   Transcript: ENSPPYT00000018932
Sequence length 140
Comment pep:known chromosome:PPYG2:6:25741253:25775920:1 gene:ENSPPYG00000016283 transcript:ENSPPYT00000018932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSMTQSLREVIKAMIKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLT
ATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDVVITAHVLKQGKTLAFTSVDL
TNKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences H2PI29
ENSPPYP00000018207 ENSPPYP00000018207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]