SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018414 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018414
Domain Number 1 Region: 411-698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-53
Family Eukaryotic proteases 0.0000275
Further Details:      
 
Domain Number 2 Region: 188-407
Classification Level Classification E-value
Superfamily vWA-like 1.15e-35
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 84-144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000737
Family Complement control module/SCR domain 0.00035
Further Details:      
 
Domain Number 4 Region: 150-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 5 Region: 24-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000528
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018414   Gene: ENSPPYG00000016469   Transcript: ENSPPYT00000019149
Sequence length 705
Comment pep:known_by_projection chromosome:PPYG2:6:32427810:32445350:1 gene:ENSPPYG00000016469 transcript:ENSPPYT00000019149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLMVLFCLLFLYPGLADLAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPRATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSN
LVLTGSEERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDITEVISSLENANYKGKSNMGGSPKTAVDHIREILNINQKRNDYLD
IYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALYQVFEHMLDVSKLTDTICGVGN
MSANASDQERTPWHVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKS
QWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTME
ANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKT
MFPSLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLG
SADKNSRKRAPRSKVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
Download sequence
Identical sequences H2PIL3
ENSPPYP00000018414 ENSPPYP00000018414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]