SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018429 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018429
Domain Number 1 Region: 208-339
Classification Level Classification E-value
Superfamily TPR-like 6.46e-28
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000115
Family FKBP immunophilin/proline isomerase 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018429   Gene: ENSPPYG00000016480   Transcript: ENSPPYT00000019164
Sequence length 349
Comment pep:known_by_projection chromosome:PPYG2:6:32616987:32618036:-1 gene:ENSPPYG00000016480 transcript:ENSPPYT00000019164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPINTIGEKDTSQPQQEWEKNLRENLDSVTQIRQQPRDPPTETLELGVSPDPASQIL
ENTHGTEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIIIRGHGLDKPKL
GSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGH
SGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences H2PIM8
ENSPPYP00000018429 9600.ENSPPYP00000018429 XP_002816727.1.23681 XP_009239984.1.23681 ENSPPYP00000018429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]