SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018463 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018463
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000235
Family LEM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018463   Gene: ENSPPYG00000016510   Transcript: ENSPPYT00000019200
Sequence length 479
Comment pep:known_by_projection chromosome:PPYG2:6:33782093:33801554:-1 gene:ENSPPYG00000016510 transcript:ENSPPYT00000019200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPRGEE
RLREEARLREDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGL
AYPARPAQLRRRASVRGSSEEDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPD
PRPGLRATRAGPAGAARAPEVGRRLERWLSRLLAPQEAEDNMKLLPVDCERKTDEFCQAK
QKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAAL
TWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESARPRMGVGCRLSRALLTAVTNVLIFF
WCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIIDVVQDHYVDWEQDMERYPYVGILHV
RDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSER
Download sequence
Identical sequences H2PIR2
ENSPPYP00000018463 9600.ENSPPYP00000018463 ENSPPYP00000018463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]