SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018489 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018489
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily FKBP-like 4.91e-41
Family FKBP immunophilin/proline isomerase 0.000000895
Further Details:      
 
Domain Number 2 Region: 256-416
Classification Level Classification E-value
Superfamily TPR-like 8.07e-33
Family Tetratricopeptide repeat (TPR) 0.0000000603
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 1.83e-26
Family FKBP immunophilin/proline isomerase 0.000000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018489   Gene: ENSPPYG00000016532   Transcript: ENSPPYT00000019226
Sequence length 457
Comment pep:known chromosome:PPYG2:6:35587187:35696461:-1 gene:ENSPPYG00000016532 transcript:ENSPPYT00000019226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Download sequence
Identical sequences H2PIT6 H2QSW0
ENSPPYP00000018489 ENSPTRP00000030899 9598.ENSPTRP00000030899 9600.ENSPPYP00000018490 ENSPPYP00000018489 ENSPTRP00000030899 XP_008970585.1.60992 XP_008970586.1.60992 XP_008970587.1.60992 XP_009449392.1.37143 XP_009449394.1.37143 XP_009449395.1.37143 XP_016810822.1.37143 XP_016810823.1.37143 XP_016810824.1.37143 XP_016810825.1.37143 XP_016810826.1.37143 XP_518427.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]