SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018532 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018532
Domain Number 1 Region: 17-180
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 8.06e-37
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018532   Gene: ENSPPYG00000016569   Transcript: ENSPPYT00000019271
Sequence length 184
Comment pep:known_by_projection chromosome:PPYG2:6:38735672:38763019:-1 gene:ENSPPYG00000016569 transcript:ENSPPYT00000019271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPAMKFSLYFLAYEDKNDIPKDRDEKIAWALSRKATLELTHNWGTEEDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Download sequence
Identical sequences H2PIX5
ENSPPYP00000018532 XP_002816884.1.23681 ENSPPYP00000018532 9600.ENSPPYP00000018532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]