SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pongo abelii 76_2 > ENSPPYP00000018596

Domain assignment for ENSPPYP00000018596 from Pongo abelii 76_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPPYP00000018596
Domain Number 1	Region: 71-319
Classification Level	Classification	E-value
Superfamily	Kelch motif	2.48e-56
Family	Kelch motif	0.01
Further Details:

Domain Number 2	Region: 11-69
Classification Level	Classification	E-value
Superfamily	Kelch motif	0.0000000418
Family	Kelch motif	0.019
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPPYP00000018596 Gene: ENSPPYG00000016627 Transcript: ENSPPYT00000019335
Sequence length	382
Comment	pep:known_by_projection chromosome:PPYG2:6:43092325:43099715:1 gene:ENSPPYG00000016627 transcript:ENSPPYT00000019335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLP PVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRV SGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGNPARWR DFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRR SHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVG DKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDI RWELNAMTTNSNISRPIVSSHG
Download sequence
Identical sequences	A0A096NI88 A0A0D9RGK8 A0A2K5MK54 A0A2K5X3M5 A0A2K6AEV7 A0A2K6B6Q7 A0A2K6Q979 F7G0N8 G2HIN0 G3S6N3 H2PJ37 ENSPPYP00000018596 NP_001233443.1.37143 XP_002816954.2.23681 XP_005553016.1.63531 XP_007970711.1.81039 XP_007970712.1.81039 XP_008957022.1.60992 XP_009449539.1.37143 XP_010367998.1.97406 XP_011752795.1.29376 XP_011752796.1.29376 XP_011752797.1.29376 XP_011815795.1.43180 XP_011842136.1.47321 XP_011927697.1.92194 XP_014991895.1.72884 XP_014991896.1.72884 XP_015304878.1.63531 XP_018884561.1.27298 XP_018884562.1.27298 9600.ENSPPYP00000018596 ENSPTRP00000031066 ENSPANP00000012686 ENSPPYP00000018596 ENSPTRP00000031066 ENSMMUP00000033670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]