SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018733 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018733
Domain Number 1 Region: 183-507
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.86e-63
Family Glutamine synthetase catalytic domain 0.00045
Further Details:      
 
Domain Number 2 Region: 73-179
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.88e-20
Family Glutamine synthetase, N-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018733   Gene: ENSPPYG00000016742   Transcript: ENSPPYT00000019475
Sequence length 509
Comment pep:known_by_projection chromosome:PPYG2:6:63483705:63529786:-1 gene:ENSPPYG00000016742 transcript:ENSPPYT00000019475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPHVCSTEVGEMDMSNSNDCMRDS
SQILTPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMP
RGYLEVIPNPKDNEMNYIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPL
LTSPRYIAKRQLSQLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPASTFLNNHDQPFM
QELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIS
SFFIETGFCNSGILSHSLWDVDRKQNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMA
PSVSCRKRYSKDRKDLKESVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL
AATVAAGLDGLHSSNEVLAGPDESTDLYQVEPSEIPLKLEDALVALEEDQCLKQALGETF
IRYFVAMKKYELENEEIAAERNKFLEYFI
Download sequence
Identical sequences H2PJH0
XP_002817083.1.23681 9600.ENSPPYP00000018733 ENSPPYP00000018733 ENSPPYP00000018733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]