SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018886 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018886
Domain Number 1 Region: 1218-1504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-52
Family Tandem AAA-ATPase domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1513-1722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.82e-47
Family Tandem AAA-ATPase domain 0.00084
Further Details:      
 
Domain Number 3 Region: 1803-1996
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.31e-45
Family Sec63 N-terminal domain 0.0000724
Further Details:      
 
Domain Number 4 Region: 1007-1180
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 5.49e-45
Family Sec63 N-terminal domain 0.0018
Further Details:      
 
Domain Number 5 Region: 421-662
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.87e-43
Family Tandem AAA-ATPase domain 0.00045
Further Details:      
 
Domain Number 6 Region: 672-884
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-42
Family Tandem AAA-ATPase domain 0.00091
Further Details:      
 
Domain Number 7 Region: 2032-2142
Classification Level Classification E-value
Superfamily E set domains 1.06e-23
Family Sec63 C-terminal domain-like 0.00056
Further Details:      
 
Domain Number 8 Region: 885-990
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000025
Family Forkhead DNA-binding domain 0.081
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018886
Domain Number - Region: 1722-1786
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000952
Family RecQ helicase DNA-binding domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018886   Gene: ENSPPYG00000016869   Transcript: ENSPPYT00000019632
Sequence length 2164
Comment pep:known_by_projection chromosome:PPYG2:6:102061660:102431382:-1 gene:ENSPPYG00000016869 transcript:ENSPPYT00000019632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEK
SKMQSINEDLKDILHAAKQIVGTDNGREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG
PFPSSSATAACNATNRIISHFSQDDLTALVQMTEKEHGDRVFFGKNLAFSFDMHDLDHFD
ELPINGETQKTISLDYKKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTE
VPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRITIVDRFLNSSND
HRFQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMKQYRREEKRIARREKKAGEDLEV
SEGLTCFDPKELRIQREQALLNARSVPILSRQRDADIEKIHYPHVYDSQAEAMKTSAFIA
GAKMILPEGIQRENNKLYEEVRIPYSEPMPLSFEEKPVYIQDLDEIGQLAFKGMKRLNRI
QSIVFETAYNTNENMLICAPTGAGKTNIAMLTVLHEIRQHFQQGVIKKNEFKIVYVAPMK
ALAAEMTNYFSRRLEPLGIVVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVA
LSQIVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATF
LHVNPYIGLFFFDGRFRPVPLGQTFLGIKCANKMQQLNNMDEVCYENVLKQVKAGHQVMV
FVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFS
IHHAGMLRQDRNLVENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVD
LGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNA
EIALGTVTNVEEAVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRK
LDKAQMIRFEERTGYFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEGDIFAIVSKAEE
FDQIKVREEEIEELDTLLSNFCELSTPGGVENSYGKINILLQTYISRGEMDSFSLISDSA
YVAQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFSILPPHILTR
LEEKKLTVDKLKDMRKDEIGHILHHVNIGLKVKQCVHQIPSVMMEASIQPITRTVLRVTL
SIYPDFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFLALKKQVISKEAQLLVFTIPIF
EPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGCKAYEA
LYNFSHFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKHPTSKAVYIAP
LKALVRERMDDWKVRIEEKLGKKVIELTGDVTPDMKSIAKADLIVTTPEKWDGVSRSWQN
RNYVQQVTILIIDEIHLLGEERGPVLEVIVSRTNFISSHTEKPVRIVGLSTALANARDLA
DWLNIKQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPAFQAIRSHSPAKPVLI
FVSSRRQTRLTALELIAFLATEEDPKQWLNMDEREMENIIATVRDSNLKLTLAFGIGMHH
AGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVIIKGTEYYDGKTRRYVDFPI
TDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLGVLSDHLNAEIA
GGTITSKQDALDYITWTYFFRRLIMNPDNRSIEPLTYGRIASYYYLKHQTVKMFKDRLKP
ECSTEELLSILSDAEEYTDLPVRHNEDHMNSELAKCLPVESNPHSFDSPHTKAHLLLQAH
LSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAANQGWLVTVLNITNLIQMVIQGRWLKD
SSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIECLPELIHACGGKDHVFSSMVESEL
HAAKTKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSVSTLTADKRDDNKWIKLHADQ
EYVLQVSLQRVHFGIHKGKPESCAVTPRFPKSKDEGWFLILGEVDKRELIALKRVGYIRN
HHVASLSFYTPEIPGRYIYTLYFMSDCYLGLDQQYDIYLNVTQASLSAQVNTKVSDSLTD
QALK
Download sequence
Identical sequences H2PJW7
ENSPPYP00000018886 ENSPPYP00000018886 9600.ENSPPYP00000018886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]