SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019022 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019022
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000222
Family LysM domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019022   Gene: ENSPPYG00000016988   Transcript: ENSPPYT00000019773
Sequence length 900
Comment pep:known_by_projection chromosome:PPYG2:6:128286456:128435708:1 gene:ENSPPYG00000016988 transcript:ENSPPYT00000019773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAIATRTHTGKEDANTVVLEPDKCNIAVE
EEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMAYTAGN
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSPGEWE
DLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPTVPLEKSTEHTTTKPSGSSVSEKL
KKLESSRETSHGSPTVTKLSKEPSDTSAAFETTAKENFLGEDDDFVDLEELSSQTGGGMD
KKDTLKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVELKGALDLETCEKQD
IMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLNKNKEGPQAGDPVTEGNKEPDKTW
VKKGEPLPVKLNSSTEANVIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIE
DILPSKEEKSKTPPMFLCIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDH
LYTFFVQWSPDVYGKDAKEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTC
SYYEDEDEEVLPVLRPHSALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYR
KSASLDSPVLLVIKDMDNQIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENS
YFINGDISSLELGGGGGRFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFE
Download sequence
Identical sequences H2PK98
ENSPPYP00000019022 ENSPPYP00000019022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]