SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019065 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019065
Domain Number 1 Region: 8-485
Classification Level Classification E-value
Superfamily ALDH-like 2.75e-155
Family ALDH-like 0.0000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019065   Gene: ENSPPYG00000017026   Transcript: ENSPPYT00000019816
Sequence length 486
Comment pep:known_by_projection chromosome:PPYG2:6:137833630:137867333:-1 gene:ENSPPYG00000017026 transcript:ENSPPYT00000019816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKALLMLENFIDGKFLPCSSYIDSYDPSGEVYCRVPNSGKDEIEAAVKAAREAFPGW
SSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSI
LHHTSECTQMDHLGCMHYTVRAAVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSE
LTSVTAWMLCKLLDKAGVPSGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITH
LSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIYS
EFLKRFVEATRKWKVGIPSDPLVSMGALISKAHLEKVRSYIKRALAEGAHIWCGEGVDKL
SLPARNQAGYFMLPTVITDIKDESCCMMEEIFGPVTCVVPFDSEEEVIERANNVKYGLAA
TVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIK
TITVKY
Download sequence
Identical sequences H2PKD9
9600.ENSPPYP00000019065 ENSPPYP00000019065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]