SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019206 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019206
Domain Number 1 Region: 169-318
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.45e-43
Family Mannose 6-phosphate receptor domain 0.000000138
Further Details:      
 
Domain Number 2 Region: 322-466
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-41
Family Mannose 6-phosphate receptor domain 0.000000596
Further Details:      
 
Domain Number 3 Region: 626-761
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-39
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1472-1603
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.79e-37
Family Mannose 6-phosphate receptor domain 0.000000104
Further Details:      
 
Domain Number 5 Region: 762-923
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-33
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 6 Region: 475-617
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-32
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 7 Region: 45-166
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-31
Family Mannose 6-phosphate receptor domain 0.000000667
Further Details:      
 
Domain Number 8 Region: 1222-1362
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.15e-31
Family Mannose 6-phosphate receptor domain 0.00017
Further Details:      
 
Domain Number 9 Region: 1076-1218
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.24e-30
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 10 Region: 1608-1753
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 11 Region: 2087-2234
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1960-2085
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.31e-28
Family Mannose 6-phosphate receptor domain 0.00094
Further Details:      
 
Domain Number 13 Region: 1369-1466
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.36e-25
Family Mannose 6-phosphate receptor domain 0.00086
Further Details:      
 
Domain Number 14 Region: 933-1077
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.06e-21
Family Mannose 6-phosphate receptor domain 0.006
Further Details:      
 
Domain Number 15 Region: 1760-1853,1902-1945
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.14e-20
Family Mannose 6-phosphate receptor domain 0.0032
Further Details:      
 
Domain Number 16 Region: 1852-1901
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-16
Family Fibronectin type II module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019206   Gene: ENSPPYG00000017149   Transcript: ENSPPYT00000019962
Sequence length 2446
Comment pep:known_by_projection chromosome:PPYG2:6:163486727:163626551:1 gene:ENSPPYG00000017149 transcript:ENSPPYT00000019962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAASRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDVVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LKKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGD
QAFDVGQPQEGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQAVSIDLTPLAQSRGSSYTSDGKEYL
FYLNVCGETETQFCNKKQAAVCQVKNSNTSQVKAAGRYQNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTKYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNLLNSSQGYEVSG
IGKIFMFNVCGTMPVCGTILGKPASGCEAETQTEDIKNLKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIIRFVCNDSVYSGPPKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPACHGSAVG
SCLVSEDNTLNLGVVQMSPQAAANGSLSIMYVNGDQCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPIVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSTGEYTYYFR
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCH
KVYQRSTAIFFYCDRSTQQPVFLKETSDCSYLFEWRTQYACPPFDLTECSFAGTEPCPPE
AAACLLGGSKPVNLGRVRDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNS
RPMFISAVEDCEYTFAWPTATACPMRSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYS
EKGLVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSG
LSYKSVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQAIECSVRNGSSIVDL
SPLIHRTGGYEAYDESEDDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPVDGPPID
IGRVAGPPILNPVANEIYLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSEC
DFVFEWETPVVCPDEVRMDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTVAA
GPEQGGCKDGGVCLLSGTKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDEGIPC
VFPFTFNGKSYEECIIESRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDI
GRPQVFSEVRGCDVTFEWKTKVVCPPKKMECKFVQKHKTYDLRLLSSLTGSWSLVHDGVS
YYINLCQKIYKGPLGCSERASICRTTTGDVQVLGLHTQKLGVIGDKVVVTYSKGYPCGGN
KTASSVIELTCTKTVGRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPING
KSFSLGDIYFKLFRASGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSR
KVGTSDKTKYYLQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETAD
CQYLFSWYTSAVCPLGVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALL
LYKKERRETVISKLTTCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEG
QENGHITTKSVKALSSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQE
REDDRVGLVRGEKARKGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences H2PKS8
ENSPPYP00000019206 ENSPPYP00000019206 9600.ENSPPYP00000019206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]